DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG31267

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:297 Identity:83/297 - (27%)
Similarity:140/297 - (47%) Gaps:47/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GAAHTMAMNLAAYGL----LENRISTLEAPRQTH-WTKKFLAKREATPHSAPYVVSIQMMTPDQG 105
            ||..|:.:.|.|...    |..|..|.|.....: ::.:.:...|:...:|||:||:|....:  
  Fly     6 GAVSTLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGN-- 68

  Fly   106 LVHYCAGTIINEHWILTAAHCLSSPQAVENSV-IVAGSHDIHDQKG---EASNIQMR-HIDYYVR 165
              |:|||:||::.|::|||.||:..:  :|:| :|..:::....:|   ...:|.|. :.|..:.
  Fly    69 --HFCAGSIIHDQWVITAASCLAGLR--KNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMY 129

  Fly   166 HELYLGGVNPYDIALIYTKEPLVFDTYVQPATL-PEQDAQPEGYGTLYGWGNVSMTAVPNYPHRL 229
            |.         |||||.|.....:|...|..|: |.:|.......|:||:|:..:..  ::..:|
  Fly   130 HN---------DIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGG--DFSWQL 183

  Fly   230 QEANMPILDMELCEQILARSGLP-LHETNLC-TGPLTGGVSICTADSGGPLIQQCCEEHFEQANI 292
            |:.::..:..|.|.  ....|.| |...:|| .|.:  |...|..|:|||::        :....
  Fly   184 QQLDVTYVAPEKCN--ATYGGTPDLDVGHLCAVGKV--GAGACHGDTGGPIV--------DSRGR 236

  Fly   293 VIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIST 329
            ::|:.:|| :|||. ..|.||.|:|.:..||   |||
  Fly   237 LVGVGNWG-VPCGY-GFPDVFARISFYYSWI---IST 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 71/249 (29%)
Tryp_SPc 84..323 CDD:214473 69/246 (28%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 69/251 (27%)
Tryp_SPc 45..268 CDD:238113 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439371
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.