DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Tmprss9

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:265 Identity:86/265 - (32%)
Similarity:125/265 - (47%) Gaps:27/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 QTHWTK--KFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVEN 135
            |..|..  :.:...||.|...|:.||::     :...|:|..|||...|:::||||.:..|....
  Rat   230 QPAWRSAGRIVGGAEAAPGEFPWQVSLR-----ENHEHFCGATIIGARWLVSAAHCFNEFQDPAQ 289

  Fly   136 SVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPE 200
            ....|||  :|....|||.::.| :....:|..|......:|:|::....||.|..|||||.||.
  Rat   290 WAAQAGS--VHLSGSEASAVRAR-VLRIAKHPAYNADTADFDVAVLELARPLPFGRYVQPACLPA 351

  Fly   201 QD--AQPEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPL 263
            ..  ..|.....:.|||.:....:.. |..||:|.:.:||..||..:...|   |.:..:|.|.|
  Rat   352 ATHVFPPRKKCLISGWGYLKEDFLVK-PEVLQKATVELLDQNLCSSLYGHS---LTDRMVCAGYL 412

  Fly   264 TGGVSICTADSGGPLIQQCCEE---HFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQ 325
            .|.|..|..||||||:   |||   .|    .:.|:|||| :.|.:...|.|:.||:...:||.:
  Rat   413 DGKVDSCQGDSGGPLV---CEEPSGRF----FLAGVVSWG-IGCAEARRPGVYTRVTRLRDWILE 469

  Fly   326 VISTA 330
            |.|:|
  Rat   470 VTSSA 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 81/246 (33%)
Tryp_SPc 84..323 CDD:214473 79/243 (33%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.