DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG3795

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:322 Identity:92/322 - (28%)
Similarity:138/322 - (42%) Gaps:60/322 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IASIMVVLSSASSGSIQLPTVRKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWTKKF 80
            :..|:::..||:|.|           ...||..|      :|....::|.|..:          |
  Fly     7 VVYILLISVSANSNS-----------ESQAGQLH------SAPSQRQDRPSDFQ----------F 44

  Fly    81 LAK---REATPHSAPYVVSIQMMTPDQ--GLVHYCAGTIINEHWILTAAHCLSSPQ---AVENSV 137
            |..   |..|.....|.||::|..|.:  |..|:|||||.:|..|||||||:.|.:   ..:..:
  Fly    45 LVTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLM 109

  Fly   138 IVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVN-PYDIALIYTKEPLVFDTYVQPATLPEQ 201
            :|||:   ..:..::|..|:...:..:.|..|..|.: .|||.||..:..|.....|  |.:|..
  Fly   110 VVAGT---PRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAV--AKIPLY 169

  Fly   202 DAQPEGYG--TLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPL- 263
            :..|....  ::.|||.|....  ..|......:|.||....||::|..|...:    ||.... 
  Fly   170 NKVPVAGAPCSIVGWGTVIQFG--PLPDEAINGDMQILPDTFCEKLLGWSNAGM----LCANDKH 228

  Fly   264 TGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQ 325
            ...|..|..|||||||   |:      |:|.||||:| |.||:.::..::..|..|.:||.:
  Fly   229 DSDVDSCQGDSGGPLI---CD------NMVTGIVSFG-MGCGEPDSAGIYTDVYHFRDWITE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 79/251 (31%)
Tryp_SPc 84..323 CDD:214473 77/247 (31%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 77/242 (32%)
Tryp_SPc 60..278 CDD:214473 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.