DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk14

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:301 Identity:75/301 - (24%)
Similarity:121/301 - (40%) Gaps:34/301 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PTVRKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQ 98
            |:...||.....|...|.........||....:...|..|:....|.|.......:|.|:.|::|
  Rat    38 PSSGLCGEQEHMGFLQTWTSGSRMLLLLTILQALAVAIVQSQGDDKILGGYTCVQNSQPWQVALQ 102

  Fly    99 MMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYY 163
               ...|....|.|.::::.|::|||||     |.....:..|.|::  ::.||:. |:..:...
  Rat   103 ---AGPGRRFLCGGVLLSDQWVITAAHC-----ARPLLHVALGKHNL--RRWEATQ-QVLRVVRQ 156

  Fly   164 VRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLYGWGNVSMTAVP--NYP 226
            |.|..|....:..|:.|:..:..:.....|:...:....|.|.....:.|||.   ||.|  .||
  Rat   157 VPHPQYRPQAHDNDLMLLKLQRKVRLGRAVRTIPVARSCASPGTPCRVSGWGT---TASPIVRYP 218

  Fly   227 HRLQEANMPILDMELCEQI---LARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFE 288
            ..||..|:.|:..::|.:.   ...||:      :|.|...||...|..||||||:   |:...:
  Rat   219 TALQCVNVNIMPEQVCHRAYPGTITSGM------VCAGVPEGGKDSCQGDSGGPLV---CQGQLQ 274

  Fly   289 QANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIST 329
                  |:||||...|.....|.|:..:..:..||.:.:.:
  Rat   275 ------GLVSWGMERCAMPGYPGVYTNLCNYHSWIQRTMQS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 64/246 (26%)
Tryp_SPc 84..323 CDD:214473 62/243 (26%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 65/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.