DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and HGF

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_000592.3 Gene:HGF / 3082 HGNCID:4893 Length:728 Species:Homo sapiens


Alignment Length:231 Identity:71/231 - (30%)
Similarity:113/231 - (48%) Gaps:34/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 HYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGG 172
            |.|.|::|.|.|:|||..|..| :.:::.....|.||:|. :|:....|:.::...|.      |
Human   517 HICGGSLIKESWVLTARQCFPS-RDLKDYEAWLGIHDVHG-RGDEKCKQVLNVSQLVY------G 573

  Fly   173 VNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYG---------TLYGWGNVSMTAVPNYPHR 228
            ....|:.|:....|.|.|.:|....||       .||         ::||||   .|.:.||...
Human   574 PEGSDLVLMKLARPAVLDDFVSTIDLP-------NYGCTIPEKTSCSVYGWG---YTGLINYDGL 628

  Fly   229 LQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIV 293
            |:.|::.|:..|.|.| ..|..:.|:|:.:|.|....|...|..|.||||:   ||:|  :..:|
Human   629 LRVAHLYIMGNEKCSQ-HHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLV---CEQH--KMRMV 687

  Fly   294 IGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIST 329
            :|::..|: .|...|.|.:||||:.:.:||:::|.|
Human   688 LGVIVPGR-GCAIPNRPGIFVRVAYYAKWIHKIILT 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 69/226 (31%)
Tryp_SPc 84..323 CDD:214473 67/223 (30%)
HGFNP_000592.3 PAN_APPLE 39..122 CDD:238074
KR 126..208 CDD:214527
KR 210..290 CDD:214527
KR 304..384 CDD:214527
KR 388..470 CDD:238056
Tryp_SPc 494..716 CDD:214473 67/223 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7084
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.