DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Tmprss11e

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_038948843.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:444 Species:Rattus norvegicus


Alignment Length:316 Identity:80/316 - (25%)
Similarity:122/316 - (38%) Gaps:78/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SIQLPTVRK----------CGGGRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAKR 84
            |:::..:.|          ||..|:...|.|..           ||....:..:..|        
  Rat   179 SVEIKKINKTESDNYLNHCCGTRRNKSTAQTSV-----------RIVGGTSAEEGEW-------- 224

  Fly    85 EATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQK 149
                   |:..|:|.    .| .|.|..|:|:..|:::||||..:.:.........|        
  Rat   225 -------PWQSSLQW----DG-SHRCGATLISNTWLVSAAHCFRTHKDPSRWTASFG-------- 269

  Fly   150 GEASNIQMRHIDYYVR----HELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPE--QDAQP--- 205
               :.:|...:...:|    ||.|....:.|||||:....|:.....|....||:  .:.||   
  Rat   270 ---ATLQPPKLTTGIRRIIVHEKYNYPSHDYDIALVELSRPVPCTNAVHKVCLPDANHEFQPGQR 331

  Fly   206 ---EGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGV 267
               .|:|.|...|     ...||   |::..:..:|.:.|.:..:.:| .:....||.|.|.|..
  Rat   332 MFVTGFGALRNDG-----FAQNY---LRQVQVDYIDTQTCNRPQSYNG-AITPRMLCAGFLKGEK 387

  Fly   268 SICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI 323
            ..|..||||||:.....:.:..|    |:||||. .|||.|.|.|:.||:||.:||
  Rat   388 DACQGDSGGPLVTPDVRDVWYLA----GVVSWGD-ECGQPNKPGVYTRVTAFRDWI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 70/252 (28%)
Tryp_SPc 84..323 CDD:214473 68/250 (27%)
Tmprss11eXP_038948843.1 SEA 71..176 CDD:396113
Tryp_SPc 213..441 CDD:238113 72/271 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.