DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk13

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:329 Identity:93/329 - (28%)
Similarity:129/329 - (39%) Gaps:82/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLSTIASIMVVLSSASSGSIQLPTVRKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHW 76
            |::|||.:.:.||...|.  ..|.:.....|.|              |.|....:.|        
  Rat     4 LVATIACLTLALSGGISR--DYPKILNGTNGTS--------------GFLPGGYTCL-------- 44

  Fly    77 TKKFLAKREATPHSAPYVVSIQMMTPDQGLVH---YCAGTIINEHWILTAAHCLSSPQAVENSVI 138
                       |||.|:..::        ||.   .|.|.:::..|:||||||......|.    
  Rat    45 -----------PHSQPWQAAL--------LVRGRLLCGGVLVHPKWVLTAAHCRKDGYTVH---- 86

  Fly   139 VAGSHDI-HDQKGEASNIQMR---HIDY-----YVRHELYLGGVNPYDIALIYTKEPLVFDTYVQ 194
             .|.|.: ..:.||.:...:|   |.:|     ::.|:        :||.|:..|.|:....:|:
  Rat    87 -LGKHALGRVENGEQAMEVVRSIPHPEYQVSPTHLNHD--------HDIMLLELKSPVQLSNHVR 142

  Fly   195 PATLPEQDAQPEG-YGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNL 258
            ...|...|..|.| ...:.|||..:...| |||..||.||:.:...|.|.|:....   :....|
  Rat   143 TLQLSADDCLPTGTCCRVSGWGTTTSPQV-NYPKTLQCANIELRSDEECRQVYPGK---ITANML 203

  Fly   259 CTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI 323
            |.|...||...|..|||||||   |.      ..:.||:|||..||||.|.|.|:.|||.:..||
  Rat   204 CAGTKEGGKDSCEGDSGGPLI---CN------GKLYGIISWGDFPCGQPNRPGVYTRVSKYLRWI 259

  Fly   324 NQVI 327
            ...|
  Rat   260 QGTI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 79/254 (31%)
Tryp_SPc 84..323 CDD:214473 77/251 (31%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 80/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.