DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Tmprss5

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:324 Identity:88/324 - (27%)
Similarity:140/324 - (43%) Gaps:71/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SASSGSI-----QLPTVRKCGGGRSAGAAHTMAMNLAAYGL--LENRISTLEAPRQTHWTKKFLA 82
            ||..||:     |..|  .|..||      .:::..:..|.  |.:||...:|.....|      
  Rat   169 SARPGSLVEEAWQPST--NCPSGR------IVSLKCSECGARPLASRIVGGQAVASGRW------ 219

  Fly    83 KREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHD 147
                     |:..|:.:     |..|.|..:::..:|::|||||:.|.:....|     |..:| 
  Rat   220 ---------PWQASVML-----GSRHTCGASVLAPYWVVTAAHCMYSFRLSRLS-----SWRVH- 264

  Fly   148 QKGEASNIQMRH-----IDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQ-PE 206
             .|..|:..:|.     ::..:.|.||....:.||:||:..:.|:.|...|....||.::.. |:
  Rat   265 -AGLVSHSAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVSAVCLPAKEQHFPQ 328

  Fly   207 GYGT-LYGWGNVSMTAVPNYPH---RLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGV 267
            |... :.|||:..    |::.|   .||:..:|:|..:||......||...|.. ||.|.|.|..
  Rat   329 GSQCWVSGWGHTD----PSHTHSSDTLQDTMVPLLSTDLCNSSCMYSGALTHRM-LCAGYLDGRA 388

  Fly   268 SICTADSGGPLIQQCCEE----HFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            ..|..||||||:   |..    |      ::|:||||: .|.:.|.|.|:.:|:.|.:||:..:
  Rat   389 DACQGDSGGPLV---CPSGDTWH------LVGVVSWGR-GCAEPNRPGVYAKVAEFLDWIHDTV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 73/255 (29%)
Tryp_SPc 84..323 CDD:214473 71/252 (28%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055 10/41 (24%)
Tryp_SPc 208..441 CDD:238113 76/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.