DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and KLK5

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:285 Identity:65/285 - (22%)
Similarity:109/285 - (38%) Gaps:77/285 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLS----- 128
            |..|....:.:.:...:...|:.|:..:: ::.|:|   .||...:::..|:||||||..     
Human    56 EDARSDDSSSRIINGSDCDMHTQPWQAAL-LLRPNQ---LYCGAVLVHPQWLLTAAHCRKKVFRV 116

  Fly   129 -------SPQAVENSVIVAG----SHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIY 182
                   ||.......:..|    .|..:...|.::::.:..::..:|                 
Human   117 RLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIR----------------- 164

  Fly   183 TKEPLVFDTYVQPATLPEQDAQP-------EGYGT---LYGWGNVSMTAVPNYPHRLQEANMPIL 237
                            |.:|.:|       ...||   :.|||......| ::|..||..|:.:|
Human   165 ----------------PTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQV-HFPKVLQCLNISVL 212

  Fly   238 DMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKM 302
            ..:.||....|.   :.:|..|.|...|..| |..|||||::   |....:      |:||||..
Human   213 SQKRCEDAYPRQ---IDDTMFCAGDKAGRDS-CQGDSGGPVV---CNGSLQ------GLVSWGDY 264

  Fly   303 PCGQKNAPSVFVRVSAFTEWINQVI 327
            ||.:.|.|.|:..:..||:||.:.|
Human   265 PCARPNRPGVYTNLCKFTKWIQETI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 62/267 (23%)
Tryp_SPc 84..323 CDD:214473 60/264 (23%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 2/11 (18%)
Tryp_SPc 66..285 CDD:214473 60/269 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.