DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk1c2

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:251 Identity:65/251 - (25%)
Similarity:114/251 - (45%) Gaps:41/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HSAPYVVSIQMMTPDQGLVHY-CAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEA 152
            :|.|:.|::        :..| |.|.:|:..|::|||||.|:     |..::.|.:::...:..|
  Rat    34 NSQPWQVAV--------INEYLCGGVLIDPSWVITAAHCYSN-----NYQVLLGRNNLFKDEPFA 85

  Fly   153 SNIQMRHIDYYVRHELYLGGV-----------NPYDIALIYTKEPLVFDTYVQPATLPEQDAQPE 206
               |.|.:....||..|:..:           :..|:.|::..||......|:...||.::.:..
  Rat    86 ---QRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGGVKVIDLPTKEPKVG 147

  Fly   207 GYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICT 271
            ......|||:.:.:.:. ..|.||..|:.:|..|.|.:....:   :.:..||.|.:.||...|.
  Rat   148 STCLASGWGSTNPSEMV-VSHDLQCVNIHLLSNEKCIETYKDN---VTDVMLCAGEMEGGKDTCA 208

  Fly   272 ADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            .|||||||   |:      .::.||.|.|..||.:...|:::.::..||.||.:|:
  Rat   209 GDSGGPLI---CD------GVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVM 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 64/248 (26%)
Tryp_SPc 84..323 CDD:214473 62/245 (25%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 62/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.