DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG30289

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:261 Identity:71/261 - (27%)
Similarity:104/261 - (39%) Gaps:63/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQ 156
            |::|.:....|       |.|::|...::||||||:|    .|:..:..|.::..|......|  
  Fly    54 PWMVLVWSSKP-------CGGSLIARQFVLTAAHCVS----FEDLYVRLGDYETLDPMPYCLN-- 105

  Fly   157 MRH---------IDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQP-ATLPEQDAQPEGYGTL 211
             .|         :|..:.||.|.|.....||||:...|.:.:..||:| ..|..:..|.....|:
  Fly   106 -NHCIPKFYNISVDMKIVHENYNGITLQNDIALLRMSEAVEYSDYVRPICLLVGEQMQSIPMFTV 169

  Fly   212 YGWGNVSMTAVPNYPHRLQEANMPILDMELC----------EQILARSGLPLHETNLCTGPLTGG 266
            .|||.   |....:...|..|.:..:|:..|          .||.|.|    |.:|.|.|     
  Fly   170 TGWGE---TEYGQFSRILLNATLYNMDISYCNIKFNKQADRSQICAGS----HTSNTCKG----- 222

  Fly   267 VSICTADSGGPLIQQCCEEHFEQANIVI----GIVSWGKMPCGQKNAPSVFVRVSAFTEWI-NQV 326
                  ||||||     ...|...|.::    |:||:|...|. .|...|:..||...||| |::
  Fly   223 ------DSGGPL-----SSKFHYGNRLLSFQYGLVSYGSERCA-ANVAGVYTNVSYHREWIFNKM 275

  Fly   327 I 327
            :
  Fly   276 V 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 71/258 (28%)
Tryp_SPc 84..323 CDD:214473 68/254 (27%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 68/254 (27%)
Tryp_SPc 42..271 CDD:238113 68/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.