DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG30082

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:270 Identity:73/270 - (27%)
Similarity:114/270 - (42%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 STLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSP 130
            :|:..|.    |.:.:..|.|...|.|::..:.   .:..||  |.||:|.:.::|||||||.|.
  Fly    30 TTINLPP----TNRIVGGRTADIGSNPWLAYLH---KNSSLV--CTGTLITKRFVLTAAHCLHSF 85

  Fly   131 QAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYL----GG--VNPYDIALIYTKEPLVF 189
            ..:   .:..|.:|...:....|...:...:.|.....|:    ||  .:..||.|:.....:|:
  Fly    86 HLL---TVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVY 147

  Fly   190 DTYVQPATLPEQDAQPEGYGTLY---GWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGL 251
            ..:::|..|.....|.. |.:.|   |||.:.:.   |....||..|:..||...||:.|     
  Fly   148 KLFIRPICLFRDPGQVP-YSSTYEAAGWGKIDLI---NTATVLQTVNLIRLDQSDCERSL----- 203

  Fly   252 PLHETNLCTGPLTGG---VSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVF 313
               .|:|..|....|   ...|:.||||||.::.......: .:.:||||:|...|   ..|.|:
  Fly   204 ---RTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITR-TVQLGIVSYGHYLC---RGPGVY 261

  Fly   314 VRVSAFTEWI 323
            ..|.:||.||
  Fly   262 TYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 70/252 (28%)
Tryp_SPc 84..323 CDD:214473 68/250 (27%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 68/255 (27%)
Tryp_SPc 40..274 CDD:238113 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.