DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk1b3

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:272 Identity:72/272 - (26%)
Similarity:118/272 - (43%) Gaps:51/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LAKREATPHSAPYVV---SIQMMT-PDQGLVHY-----CAGTIINEHWILTAAHCLSSPQAVENS 136
            |.:.:|.|.....||   :.:|.: |.|..|:|     |.|.:|:..|::|||||     |.:|.
  Rat    16 LGRNDAAPPVQSRVVGGYNCEMNSQPWQVAVYYFGEYLCGGVLIDPSWVITAAHC-----ATDNY 75

  Fly   137 VIVAGSHDIHDQKGEASNIQMRHI-----------DYYVRHELYLGGVNPYDIALIYTKEPLVFD 190
            .:..|.:::::.:..|   |.|.:           |....|....|.....|:.|::..:|....
  Rat    76 QVWLGRNNLYEDEPFA---QHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSNDLMLLHLSQPADIT 137

  Fly   191 TYVQPATLPEQDAQPEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELC-----EQILARSG 250
            ..|:...||.::.:........|||:::...: .....||..|:.:|..|.|     |::.    
  Rat   138 DGVKVIDLPIEEPKVGSTCLASGWGSITPDGL-ELSDDLQCVNIDLLSNEKCVEAHKEEVT---- 197

  Fly   251 LPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVR 315
                :..||.|.:.||...|..|||||||   |.      .::.||.|||..|||:...|.::.:
  Rat   198 ----DLMLCAGEMDGGKDTCKGDSGGPLI---CN------GVLQGITSWGFNPCGEPKKPGIYTK 249

  Fly   316 VSAFTEWINQVI 327
            :..||.||.:|:
  Rat   250 LIKFTPWIKEVM 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 70/266 (26%)
Tryp_SPc 84..323 CDD:214473 68/263 (26%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 66/254 (26%)
Tryp_SPc 29..260 CDD:238113 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.