DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Ovch2

DIOPT Version :10

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_766496.2 Gene:Ovch2 / 244199 MGIID:3045251 Length:609 Species:Mus musculus


Alignment Length:260 Identity:82/260 - (31%)
Similarity:119/260 - (45%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHD-QKGE-- 151
            |.|:.||::     |...|.|.||||:..|::|||||:::........:.||.||:.. :.||  
Mouse    62 SYPWQVSLK-----QKQKHICGGTIISSQWVITAAHCMANRNIALTLNVTAGEHDLSQAEPGEQT 121

  Fly   152 -ASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYG-----T 210
             |....:.|..:..|..:.      |||||:.......|..:|:|..|||..   |.:.     |
Mouse   122 LAIETIIIHPQFSTRKPMI------YDIALLKMAGTFQFGQFVRPVCLPEPG---EHFNAGFICT 177

  Fly   211 LYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPL-HETNLCTGPLTGGVSICTADS 274
            ..|||.:|...  ..|..||:.|:|||..|.||.:|.....|: .:|.||||...||...|..||
Mouse   178 TAGWGRLSEGG--RLPQVLQQVNLPILTQEECEAVLLTLKNPITGKTFLCTGSPDGGRDACQGDS 240

  Fly   275 GGPLIQQCCEEHFEQANIVIGIVSWGKMPCG----------QKNAPSVFVRVSAFTEWINQVIST 329
            ||.|:   |:.. :.|..:.|:.||| :.||          ::.:|.:|..:.....||.:.|.|
Mouse   241 GGSLM---CQNR-KGAWTLAGVTSWG-LGCGRSWRNNARKKEQGSPGIFTDLRRVLPWILKHIQT 300

  Fly   330  329
            Mouse   301  300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 80/255 (31%)
Ovch2NP_766496.2 Tryp_SPc 52..297 CDD:238113 80/255 (31%)
CUB 317..420 CDD:238001
CUB 431..542 CDD:238001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 580..609
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.