DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk7

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:242 Identity:70/242 - (28%)
Similarity:112/242 - (46%) Gaps:32/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGE--A 152
            |.|:.|::.     :|...:|.|.:::::|:||||||......|:     .||..|.||..:  .
Mouse    36 SHPWQVALL-----KGNQLHCGGVLVDKYWVLTAAHCKMGQYQVQ-----LGSDKIGDQSAQKIK 90

  Fly   153 SNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLYGWGNV 217
            :....||..|..:..     ||  ||.|:...||:...:.|:...|||....|....|:.|||..
Mouse    91 ATKSFRHPGYSTKTH-----VN--DIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTSCTVSGWGTT 148

  Fly   218 SMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQC 282
            :...| .:|..|..:::.::....|:::....   |.:|.||.|......:.|..||||||:   
Mouse   149 TSPDV-TFPSDLMCSDVKLISSRECKKVYKDL---LGKTMLCAGIPDSKTNTCNGDSGGPLV--- 206

  Fly   283 CEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIST 329
            |.:..:      |:||||..||||.|.|.|:.:|..:..|:.:.:.|
Mouse   207 CNDTLQ------GLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETMKT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 69/237 (29%)
Tryp_SPc 84..323 CDD:214473 68/234 (29%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 68/234 (29%)
Serine protease. /evidence=ECO:0000250 26..246 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.