DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and svh-1

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:253 Identity:71/253 - (28%)
Similarity:121/253 - (47%) Gaps:32/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQK 149
            |..|.:.|:..:::.....   .|:|..:|:::..::|||||....:.|.:..:|.|..|.:...
 Worm   718 ETVPGAFPWTAALRNKATK---AHHCGASILDKTHLITAAHCFEEDERVSSYEVVVGDWDNNQTD 779

  Fly   150 GEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEP-LVFDTYVQPATLPEQD--AQPEGYGTL 211
            |......::.|.:|..::    .:..:|||::....| :.|:.|.||..||.:|  ..|.....:
 Worm   780 GNEQIFYLQRIHFYPLYK----DIFSHDIAILEIPYPGIEFNEYAQPICLPSKDFVYTPGRQCVV 840

  Fly   212 YGWGNVSMTAVPNYPHRLQEANMPILDMELC---EQI---LARSGLPLHETNLCTGPLTGGVSIC 270
            .|||::.:    .|..|||.|.:||::...|   .||   ::||.       .|.|.|.||:..|
 Worm   841 SGWGSMGL----RYAERLQAALIPIINRFDCVNSSQIYSSMSRSA-------FCAGYLEGGIDSC 894

  Fly   271 TADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIS 328
            ..|||||.  .|..|  :.|.::.|::|||. .|.||..|.::..|:.:..||:.:|:
 Worm   895 QGDSGGPF--ACRRE--DGAFVLAGVISWGD-GCAQKKQPGIYTMVAPYLSWISAIIN 947

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 70/249 (28%)
Tryp_SPc 84..323 CDD:214473 68/246 (28%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 70/249 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.