DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk1b4

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_035045.2 Gene:Klk1b4 / 18048 MGIID:97320 Length:256 Species:Mus musculus


Alignment Length:256 Identity:74/256 - (28%)
Similarity:114/256 - (44%) Gaps:47/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAV---ENSVIVAGSHDIHDQKG 150
            :|.|:.|::......|     |.|.:::.:|:||||||.:....|   :|:.:.....|.|....
Mouse    29 NSQPWHVAVYRFNKYQ-----CGGVLLDRNWVLTAAHCYNDKYQVWLGKNNFLEDEPSDQHRLVS 88

  Fly   151 EASNIQMRHIDYYVRHELYLGGVNPY-------DIALIYTKEPLVFDTYVQPATLPEQDAQPEGY 208
            :|    :.|.|:.:.   .|....|.       |:.|:...:|......|:|.|||.::.:....
Mouse    89 KA----IPHPDFNMS---LLNEHTPQPEDDYSNDLMLLRLSKPADITDVVKPITLPTEEPKLGST 146

  Fly   209 GTLYGWGNVSMTAVP-NYPHRLQEANMPILDMELCEQILARSGLPLHETN-----LCTGPLTGGV 267
            ....|||  |.|.:. .||..||..|:.:|..|.|::        .||..     ||.|.:.||.
Mouse   147 CLASGWG--STTPIKFKYPDDLQCVNLKLLPNEDCDK--------AHEMKVTDAMLCAGEMDGGS 201

  Fly   268 SICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIS 328
            ..|..|||||||   |:      .|:.||.|||..|||:...|||:.::..|:.||.:.::
Mouse   202 YTCEHDSGGPLI---CD------GILQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 74/252 (29%)
Tryp_SPc 84..323 CDD:214473 72/249 (29%)
Klk1b4NP_035045.2 Tryp_SPc 13..251 CDD:238113 74/252 (29%)
Activation peptide homolog 18..24
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.