DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk1b8

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_032483.1 Gene:Klk1b8 / 16624 MGIID:892018 Length:261 Species:Mus musculus


Alignment Length:251 Identity:64/251 - (25%)
Similarity:114/251 - (45%) Gaps:37/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEAS 153
            :|.|:.|::.     ....|.|.|.::..:|:||||||.     |:...:..|.:.:..::..| 
Mouse    34 NSQPWQVAVY-----DNKEHICGGVLLERNWVLTAAHCY-----VDQYEVWLGKNKLFQEEPSA- 87

  Fly   154 NIQMRHIDYYVRH-----------ELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEG 207
              |.|.:.....|           |:..|.....|:.|:...:|......|:|.|||.::::...
Mouse    88 --QHRLVSKSFPHPGFNMSLLTLKEIPPGADFSNDLMLLRLSKPADITDAVKPITLPTKESKLGS 150

  Fly   208 YGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTA 272
            .....|||:::.|.... |..||...:.:|.::.|   :....:.:.:..||.|.::||.:||..
Mouse   151 TCLASGWGSITPTKWQK-PDDLQCVFLKLLPIKNC---IENHNVKVTDVMLCAGEMSGGKNICKG 211

  Fly   273 DSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIS 328
            |||||||   |:      :::.||.|.|.:|||:...|:::..:..|..||...::
Mouse   212 DSGGPLI---CD------SVLQGITSTGPIPCGKPGVPAMYTNLIKFNSWIKDTMT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 64/247 (26%)
Tryp_SPc 84..323 CDD:214473 62/244 (25%)
Klk1b8NP_032483.1 Tryp_SPc 24..253 CDD:214473 62/244 (25%)
Tryp_SPc 25..256 CDD:238113 64/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.