DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk1b1

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_034775.1 Gene:Klk1b1 / 16623 MGIID:892019 Length:261 Species:Mus musculus


Alignment Length:273 Identity:71/273 - (26%)
Similarity:118/273 - (43%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PRQTHWTKKFLAKREATP-HSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVE 134
            |.|:.....|..::.:.| |.|.|          :...:.|.|.:::.:|:||||||.     .|
Mouse    20 PVQSRIVGGFKCEKNSQPWHVAVY----------RYKEYICGGVLLDANWVLTAAHCY-----YE 69

  Fly   135 NSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGV------NP-----YDIALIYTKEPLV 188
            .:.:..|.::::..:..|   |.|.:.....|..|...:      ||     ||:.|:...:|..
Mouse    70 KNNVWLGKNNLYQDEPSA---QHRLVSKSFLHPCYNMSLHRNRIQNPQDDYSYDLMLLRLSKPAD 131

  Fly   189 FDTYVQPATLPEQDAQPEGYGTLYGWGNVSMTAVP---NYPHRLQEANMPILDMELCEQILARSG 250
            ....|:|..||.::.:........|||::    :|   .|...||..|:.:|..|.|::...:. 
Mouse   132 ITDVVKPIALPTEEPKLGSTCLASGWGSI----IPVKFQYAKDLQCVNLKLLPNEDCDKAYVQK- 191

  Fly   251 LPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVR 315
              :.:..||.|...||...|..|||||||   |:      .::.|:.|||..|||:...|.|:.:
Mouse   192 --VTDVMLCAGVKGGGKDTCKGDSGGPLI---CD------GVLQGLTSWGYNPCGEPKKPGVYTK 245

  Fly   316 VSAFTEWINQVIS 328
            :..||.||...::
Mouse   246 LIKFTSWIKDTLA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 68/256 (27%)
Tryp_SPc 84..323 CDD:214473 66/253 (26%)
Klk1b1NP_034775.1 Tryp_SPc 24..253 CDD:214473 67/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.