DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klkb1

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_032481.2 Gene:Klkb1 / 16621 MGIID:102849 Length:638 Species:Mus musculus


Alignment Length:247 Identity:72/247 - (29%)
Similarity:115/247 - (46%) Gaps:43/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQ 156
            |:.||:|:....|  .|.|.|:||...|:||||||.......:...|..|...:.:...|..:.:
Mouse   403 PWQVSLQVKLVSQ--THLCGGSIIGRQWVLTAAHCFDGIPYPDVWRIYGGILSLSEITKETPSSR 465

  Fly   157 MRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLY------GWG 215
            ::.:   :.|:.|......||||||..:.||.:..:.:|..||.:    ....|:|      |||
Mouse   466 IKEL---IIHQEYKVSEGNYDIALIKLQTPLNYTEFQKPICLPSK----ADTNTIYTNCWVTGWG 523

  Fly   216 ---------NVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICT 271
                     |:           ||:|.:|::..|.|::  ......:::..:|.|...||...|.
Mouse   524 YTKEQGETQNI-----------LQKATIPLVPNEECQK--KYRDYVINKQMICAGYKEGGTDACK 575

  Fly   272 ADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI 323
            .||||||:   | :|..:..:| ||.|||: .|.:|:.|.|:.:||.:.:||
Mouse   576 GDSGGPLV---C-KHSGRWQLV-GITSWGE-GCARKDQPGVYTKVSEYMDWI 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 72/247 (29%)
Tryp_SPc 84..323 CDD:214473 70/245 (29%)
Klkb1NP_032481.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 70/245 (29%)
Tryp_SPc 391..621 CDD:238113 70/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.