DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk1b27

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_064664.1 Gene:Klk1b27 / 16619 MGIID:891980 Length:263 Species:Mus musculus


Alignment Length:268 Identity:72/268 - (26%)
Similarity:118/268 - (44%) Gaps:37/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVEN 135
            |.|:.....|..|:    :|.|:.|::.....     :.|.|.:::.:|:||||||..:..:..|
Mouse    20 PVQSRIIGGFKCKK----NSQPWHVAVLRSNK-----YICGGVLLDPNWVLTAAHCYGNDTSQHN 75

  Fly   136 SVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELY----LGGVNPY------DIALIYTKEPLVFD 190
              :..|.:.:..::..|   |.|.:.....|..|    |....|:      |:.|:...:|....
Mouse    76 --VWLGKNKLFQREPSA---QHRWVSKSFPHPDYNMSLLNDHIPHPEDKSNDLMLLRLSKPADIT 135

  Fly   191 TYVQPATLPEQDAQPEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHE 255
            ..|:|..||.::.:........|||:::.|.. ..|:.||...:.:|..|.|.:.....   :.:
Mouse   136 DAVKPIDLPTEEPKLGSTCLASGWGSITPTKY-QIPNDLQCVFIKLLPNENCAKAYVHK---VTD 196

  Fly   256 TNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFT 320
            ..||.|...||...|..|||||||   |:      .::.||.|||.:||.:.|||.||.::..||
Mouse   197 VMLCVGETGGGKGTCKGDSGGPLI---CD------GVLHGITSWGSIPCAKPNAPGVFTKLIKFT 252

  Fly   321 EWINQVIS 328
            .||...::
Mouse   253 SWIKDTMA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 68/251 (27%)
Tryp_SPc 84..323 CDD:214473 66/248 (27%)
Klk1b27NP_064664.1 Tryp_SPc 24..255 CDD:214473 68/257 (26%)
Tryp_SPc 25..258 CDD:238113 70/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.