DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk1b24

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_034773.1 Gene:Klk1b24 / 16617 MGIID:892021 Length:263 Species:Mus musculus


Alignment Length:235 Identity:69/235 - (29%)
Similarity:108/235 - (45%) Gaps:36/235 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 HYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELY--- 169
            :.|.|.::|.:|:||||||..:..:..|  :..|.:.:..::..|   |.|.:.....|..|   
Mouse    48 YICGGVLLNPNWVLTAAHCYGNATSQYN--VWLGKNKLFQREPSA---QHRWVSKSFPHPDYNMS 107

  Fly   170 -LGGVNPY------DIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLYGWGNVSMTAVPNYPH 227
             |....|.      |:.|:...||......|:|..||.::.:........|||:::.|.... |:
Mouse   108 LLNDDIPQPKDKSNDLMLLRLSEPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKWQK-PN 171

  Fly   228 RLQEANMPILDMELCEQILARSGLP-LHETN---LCTGPLTGGVSICTADSGGPLIQQCCEEHFE 288
            .||...:.:|..|.|.:       | ||:..   ||.|.:.||...|..|||||||   |:    
Mouse   172 DLQCVFIKLLPNENCTK-------PYLHKVTDVMLCAGEMGGGKDTCAGDSGGPLI---CD---- 222

  Fly   289 QANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIS 328
              .|:.||.|||.:|||:.|||:::.::..|..||...::
Mouse   223 --GILHGITSWGPVPCGKPNAPAIYTKLIKFASWIKDTMA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 69/231 (30%)
Tryp_SPc 84..323 CDD:214473 67/228 (29%)
Klk1b24NP_034773.1 Tryp_SPc 24..255 CDD:214473 67/228 (29%)
Tryp_SPc 25..258 CDD:238113 69/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.