DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG12256

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:240 Identity:75/240 - (31%)
Similarity:113/240 - (47%) Gaps:25/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQ 156
            ||.||:|.:|....:.|:|.|::|..:.:||||||::...|...|| |||..|::|..|..|.:|
  Fly    60 PYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISV-VAGIRDLNDSSGFRSQVQ 123

  Fly   157 MRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYG---TLYGWGNV- 217
            .     |..:|.|...|.. |||::....|...|. .:.:|:....:...|..   .|.|||:| 
  Fly   124 S-----YEMNENYQELVTS-DIAILKIDPPFELDE-KRVSTIDVSGSDMVGADQEVLLTGWGSVF 181

  Fly   218 --SMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQ 280
              .......||..||:.:...|....|::.:.:    |.:|.:|... ..|...|..||||||:.
  Fly   182 HFGTGPFAKYPTVLQKLDYKTLSNSKCKETMTQ----LTDTEICALE-RFGKGACNGDSGGPLVM 241

  Fly   281 QCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQ 325
            :..|.:.:     :|:||:|...|...| |.|:.|||.|..||.:
  Fly   242 KSGESYKQ-----VGVVSYGTAFCASNN-PDVYTRVSMFDGWIKE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 75/240 (31%)
Tryp_SPc 84..323 CDD:214473 73/236 (31%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 73/236 (31%)
Tryp_SPc 47..280 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.