DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk1b9

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_034246.1 Gene:Klk1b9 / 13648 MGIID:95293 Length:261 Species:Mus musculus


Alignment Length:264 Identity:67/264 - (25%)
Similarity:113/264 - (42%) Gaps:63/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEAS 153
            :|.|:.|::.....     :.|.|.:::.:|:||||||.     .|.:.:..|.:::::::..|.
Mouse    34 NSQPWHVAVYRYNE-----YICGGVLLDANWVLTAAHCY-----YEENKVSLGKNNLYEEEPSAQ 88

  Fly   154 ----NIQMRHIDY-------YVRHELYLGGVNPY--DIALIYTKEPLVFDTYVQPATLPEQDAQP 205
                :....|..|       ::||..|     .|  |:.|:...:|......|:|..||.::.:.
Mouse    89 HRLVSKSFLHPGYNRSLHRNHIRHPEY-----DYSNDLMLLRLSKPADITDVVKPIALPTEEPKL 148

  Fly   206 EGYGTLYGWGNVSMTAVPNYPHRLQEA------NMPILDMELC-----EQILARSGLPLHETNLC 259
            .......|||:.:       |.:.|.|      |:.:|..|.|     |::.        :..||
Mouse   149 GSTCLASGWGSTT-------PFKFQNAKDLQCVNLKLLPNEDCGKAHIEKVT--------DVMLC 198

  Fly   260 TGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWIN 324
            .|...||...|..|||||||   |:      .::.||.|||..|||:...|.|:.::..||.||.
Mouse   199 AGETDGGKDTCKGDSGGPLI---CD------GVLQGITSWGFTPCGEPKKPGVYTKLIKFTSWIK 254

  Fly   325 QVIS 328
            ..::
Mouse   255 DTMA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 67/260 (26%)
Tryp_SPc 84..323 CDD:214473 65/257 (25%)
Klk1b9NP_034246.1 Tryp_SPc 24..253 CDD:214473 65/257 (25%)
Tryp_SPc 25..256 CDD:238113 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.