DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and LOC1281971

DIOPT Version :10

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_321961.3 Gene:LOC1281971 / 1281971 VectorBaseID:AGAMI1_007079 Length:260 Species:Anopheles gambiae


Alignment Length:54 Identity:15/54 - (27%)
Similarity:20/54 - (37%) Gaps:12/54 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FDECQSMPCVPKPQQRSPNASFN----------PAHAQY--ACCFQQLHSNTGA 44
            |||...:....|.:..:.|||.|          |..|.|  ......:|.:|||
Mosquito   472 FDEFDLITNRNKSEHSNSNASNNNNASLLDDMDPLSANYGNGGINSSMHPSTGA 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113
LOC1281971XP_321961.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.