DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk5

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_038952099.1 Gene:Klk5 / 102546758 RGDID:1593461 Length:293 Species:Rattus norvegicus


Alignment Length:224 Identity:66/224 - (29%)
Similarity:94/224 - (41%) Gaps:31/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHD--QKGEASNIQMRHIDYYVRHELYLG 171
            ||...:||..|:||||||......:.     .|.|.:..  :.|:    ||......:.|..|..
  Rat    93 YCGAVLINPQWLLTAAHCRKPVFRIR-----LGHHSMSPVYESGQ----QMFQGIKSIPHPGYSH 148

  Fly   172 GVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLY-GWGNVSMTAVPNYPHRLQEANMP 235
            ..:..|:.||.....:.....|:|..: ..|...||...:. |||..| ::..|:|..||..::.
  Rat   149 PGHSNDLMLIKMNRKIRASHSVKPVEI-TSDCPKEGTRCMVSGWGTTS-SSHNNFPKVLQCLDIT 211

  Fly   236 ILDMELCEQILARSGLP--LHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVS 298
            :|..|.|     ::..|  :.:|..|.|...|..| |..|||||:|   |....:      |:||
  Rat   212 VLSEERC-----KNSYPGQIDKTMFCAGDEAGRDS-CQGDSGGPVI---CNGKLQ------GLVS 261

  Fly   299 WGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            ||..||.|.|.|.|:..:..|..||...|
  Rat   262 WGDFPCAQPNRPGVYTNLCEFVPWIKDTI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 65/221 (29%)
Tryp_SPc 84..323 CDD:214473 63/218 (29%)
Klk5XP_038952099.1 Tryp_SPc 67..286 CDD:214473 63/218 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.