DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and LOC101732100

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_031749505.1 Gene:LOC101732100 / 101732100 -ID:- Length:327 Species:Xenopus tropicalis


Alignment Length:233 Identity:68/233 - (29%)
Similarity:113/233 - (48%) Gaps:23/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLG 171
            |:.|.||:::..|:::||||||...|...:||: |::.:...:.|...:.:::|  |: |..|..
 Frog    59 VYRCGGTLVSSKWVVSAAHCLSRSNASCLAVIL-GANKLSGNENEEMAVSVKNI--YI-HPNYND 119

  Fly   172 GVNPYDIALIYTKEPLVFDTYVQPATLPEQDA--QPEGYGTLYGWG----NVSMTAVPNYPHRLQ 230
            .....||.|....:.:.|.:||.|..||....  .|.....:.|||    |.|::     |:.||
 Frog   120 TDITNDIGLAELTQAVSFTSYVIPVCLPTASTIFNPGQSCWVTGWGVTEFNTSLS-----PNTLQ 179

  Fly   231 EANMPILDMELCEQILAR--SGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIV 293
            |..|.||..|.|......  :|:.:.:..:|...:.||...|..||||||:   |.  :.....:
 Frog   180 EVQMRILSAEQCRSYYDPNITGVYITDQMICARDILGGKDSCQGDSGGPLV---CS--YGGNFYL 239

  Fly   294 IGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVISTAT 331
            :|:||:| :.||....|.|:..|.|:.:||.:.:.:.:
 Frog   240 VGVVSFG-IGCGDTAYPGVYTYVPAYRDWIGKYVPSVS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 68/226 (30%)
Tryp_SPc 84..323 CDD:214473 66/223 (30%)
LOC101732100XP_031749505.1 Tryp_SPc 37..268 CDD:238113 66/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.