DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and LOC100535114

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_009296342.3 Gene:LOC100535114 / 100535114 -ID:- Length:329 Species:Danio rerio


Alignment Length:256 Identity:76/256 - (29%)
Similarity:119/256 - (46%) Gaps:32/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKG 150
            ||..|.|::||::     :..||:|.|::||..|:||||||:|........|.:.........:.
Zfish    42 ATEGSWPWMVSLR-----KSGVHFCGGSLINNQWVLTAAHCISGKTTSSMHVYLGKWRRYETDQN 101

  Fly   151 EASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQ-PEGYGT-LYG 213
            |.:    |.:...:.|..|....:..||||:.....:.:..|::|..|.:|::. |.|..: :.|
Zfish   102 EIT----RTVIDIIPHPSYNNRTSDNDIALLQLSATVQYTVYIKPICLADQNSNFPRGTRSWVTG 162

  Fly   214 WGNVSMT-----------AVP-NYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGG 266
            ||.:.::           :|| ..|..|||..:.:...|.|.:   |...|:....:|.|..:||
Zfish   163 WGRIGVSGTGGISGRTTVSVPLPAPGILQEVELQVYSNEKCSK---RCQGPITPNMICAGTRSGG 224

  Fly   267 VSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            ......||||||:.:.|.. :.||    |:||.| ..|.|...|.||:|||.:.:||...|
Zfish   225 KGTFYGDSGGPLMSKQCSV-WVQA----GVVSHG-YGCAQPKIPGVFIRVSEYKQWITDNI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 75/253 (30%)
Tryp_SPc 84..323 CDD:214473 73/250 (29%)
LOC100535114XP_009296342.3 Tryp_SPc 36..278 CDD:238113 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.