DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and LOC100331291

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_009295692.1 Gene:LOC100331291 / 100331291 -ID:- Length:932 Species:Danio rerio


Alignment Length:310 Identity:92/310 - (29%)
Similarity:136/310 - (43%) Gaps:47/310 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PTVRKCGGGRSAGAAHTMAMNLAAYGLL-------ENRISTLEAPRQTHWTKKFLAKREATPHSA 91
            |:..||..|:...     .||....|:.       |.|......||:   ..|.:...:|...|.
Zfish   646 PSSFKCASGKCLN-----KMNPECDGIKDCKDGSDELRCGCGTRPRK---RAKIVGGTDAQAGSW 702

  Fly    92 PYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENS-----VIVAGSHDIHDQKGE 151
            |:.||:||    :...|.|..:::...|:::||||.....|::.|     ....|...::.....
Zfish   703 PWQVSLQM----ERYGHVCGASLVASRWLVSAAHCFQDSDAIKYSDARSWRAYMGMRVMNSVSNA 763

  Fly   152 ASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGT------ 210
            |:..|:|.|   |.|..|....:.|||||:....|:.|:..|||..:|    .|....|      
Zfish   764 AATRQIRRI---VLHSQYDQFTSDYDIALLELSAPVFFNELVQPVCVP----APSHVFTSGTSCF 821

  Fly   211 LYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSG 275
            :.|||  .:|........||||.:.|::...|.::...:..|   ..||.|.:.|||..|..|||
Zfish   822 VTGWG--VLTEEGELATLLQEATVNIINHNTCNKMYDDAVTP---RMLCAGNIQGGVDACQGDSG 881

  Fly   276 GPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQ 325
            |||:  |.|.  .:...:.||||||: .|.::|.|.|:.||..||:||:|
Zfish   882 GPLV--CLER--GRRWFLAGIVSWGE-GCARQNRPGVYTRVIKFTDWIHQ 926

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 80/253 (32%)
Tryp_SPc 84..323 CDD:214473 77/249 (31%)
LOC100331291XP_009295692.1 SEA 136..>220 CDD:307516
CUB 315..415 CDD:238001
CUB 421..528 CDD:238001
LDLa 536..568 CDD:238060
LDLa 606..636 CDD:238060
LDLa 644..679 CDD:238060 8/37 (22%)
Tryp_SPc 691..927 CDD:238113 80/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.