DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and LOC100004427

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:314 Identity:80/314 - (25%)
Similarity:123/314 - (39%) Gaps:89/314 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 AGAAHTMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHY 109
            |||   :.:|:|  |.|........||..|    |.:....||..|.|:..||...:..|   .:
Zfish    10 AGA---VLLNIA--GCLGQSDVCGRAPLNT----KIVGGLNATEGSWPWQASINFKSTGQ---FF 62

  Fly   110 CAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLG--- 171
            |:|::|:|.|:||||.|.   |.:..|.:|                            :|||   
Zfish    63 CSGSLISERWVLTAASCF---QRINVSDVV----------------------------IYLGRLT 96

  Fly   172 --GVNPY-------------DIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLY--------- 212
              |.|||             ||||:.....:.|..|::|..|       ...|:::         
Zfish    97 TNGSNPYEIPRTVIQVSVTEDIALVQLSSSVTFTDYIRPVCL-------AAAGSVFVDGTESWVT 154

  Fly   213 GWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLT-GGVSICTADSGG 276
            |||:.|.|.| .....|:|...||::...|..|   :|:...:..:|.|.:. .|.:.|..|.|.
Zfish   155 GWGSTSSTNV-ILSDMLKEVEAPIVNNIECSNI---NGITNLDNVICAGFVNETGKAPCWEDFGS 215

  Fly   277 PLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVISTA 330
            ||:.:...:..:...:|...       |||...|:::.|||.:.|||....|::
Zfish   216 PLVTRQGSQWIQSGVVVFTF-------CGQNGFPTLYARVSEYEEWIRNYTSSS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 68/269 (25%)
Tryp_SPc 84..323 CDD:214473 66/266 (25%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 67/271 (25%)
Tryp_SPc 36..257 CDD:238113 68/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.