DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:268 Identity:87/268 - (32%)
Similarity:130/268 - (48%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGS 142
            |:.:...||:|.|.|:.|.|||.:..    |.|.|:||.::|:|:||||..:|..|....:..|.
Zfish    30 KRIVGGVEASPGSWPWQVDIQMGSNG----HVCGGSIIAKNWVLSAAHCFPNPSEVSAYTLYMGR 90

  Fly   143 HDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPY---DIALIYTKEPLVFDTYVQPATLPEQDAQ 204
            |.::...      |...:.|..|..:..|..:|.   |:||:..:.|:.:...:||..||..|.|
Zfish    91 HLLNGYN------QFEKVSYVQRVVIPEGYTDPQGGRDVALVQLRAPVSWTDRIQPVCLPFADFQ 149

  Fly   205 PEGYGTL---YGWGN----VSMTAVPNYPHRLQEANMPILDMELCE---QILA--RSGLPLHETN 257
            ... |||   .|||:    ||:|...    .|:|..:||:|...|:   |||:  .|.:.:....
Zfish   150 FNS-GTLCYVTGWGHKQEGVSLTGAA----ALREVEVPIIDQSSCQFMYQILSSDSSTVDILSDM 209

  Fly   258 LCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEW 322
            :|.|...||...|..||||||:.......:.||    |:||:| :.|.|||.|.::.|||:|.:.
Zfish   210 ICAGYKEGGKDSCQGDSGGPLVCPVGNGTWIQA----GVVSFG-LGCAQKNRPGIYSRVSSFEKL 269

  Fly   323 INQVISTA 330
            |...:..|
Zfish   270 IRTTVPEA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 85/256 (33%)
Tryp_SPc 84..323 CDD:214473 84/253 (33%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 85/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.