DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and YOX1

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_013685.1 Gene:YOX1 / 854981 SGDID:S000004489 Length:385 Species:Saccharomyces cerevisiae


Alignment Length:331 Identity:75/331 - (22%)
Similarity:129/331 - (38%) Gaps:81/331 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 SSLDVGKSFTIAAILGLQSQRKDY-------------NNAIN-------------LSLHDNNNII 201
            ||..|..|||        :.|..:             |.:||             .|||:|::..
Yeast    21 SSSPVSPSFT--------NPRTSFHLDDRGTIKLPPLNTSINRPRSVESALRHTVTSLHENSSAY 77

  Fly   202 GDDNNKCYTSNP--NNNNNNNNNGGSNSGNNNSSPSVNNFNCD-SVAGNGRYLHGGHQHPHPHQA 263
            |||..|...|:.  ::..|::......|..|.....:|:...| ||:....              
Yeast    78 GDDMLKHTQSDSALSSQLNSSQETVDESHENLLLTPLNSKKRDYSVSSKKN-------------- 128

  Fly   264 GFAAVAAAVGAAPSALQSLQQLHQQH------HAQQQATLSFQREKLKSDSHKKSALKNKRVRTI 322
               .:...:.||.|.:.......::.      |:|:    :|.:::.|.|:  ....:.||.|| 
Yeast   129 ---DILTPLSAAKSIIIPSASKEKRRAFAFITHSQE----TFPKKEPKIDN--APLARRKRRRT- 183

  Fly   323 FTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQRLA--- 384
             :.::|..|:||||:.......:|:.||.:..:||..|::||||:|       ..:.:||:|   
Yeast   184 -SSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKR-------QAVKRQRIATSK 240

  Fly   385 --LIRQTQLPGTSLLGNQVSVSANAAHSVSTERTNGCSAASPSLQEEDNED-SKHSLSLSGALPP 446
              .|.||..|.:..|....:..|:...:......:.||.:|.|...|:... ..|||:...:.|.
Yeast   241 STTIIQTVSPPSPPLDVHATPLASRVKADILRDGSSCSRSSSSSPLENTPPRPHHSLNRRSSTPS 305

  Fly   447 LSRAQS 452
            :.|:|:
Yeast   306 IKRSQA 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 19/51 (37%)
YOX1NP_013685.1 COG5576 126..267 CDD:227863 38/172 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.