DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and HMRA1

DIOPT Version :10

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_010021.1 Gene:HMRA1 / 850459 SGDID:S000000694 Length:126 Species:Saccharomyces cerevisiae


Alignment Length:80 Identity:23/80 - (28%)
Similarity:42/80 - (52%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 QQATL--SFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKL 355
            :|.||  :....:|:...|.|.. |:.:.::..:|:....||..|.|:|.:...|:..:|....:
Yeast    46 EQHTLHKNISNNRLEIYHHIKKE-KSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGI 109

  Fly   356 TEAQVKVWFQNRRIK 370
            |..||:|||.|:|::
Yeast   110 TPLQVRVWFINKRMR 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeodomain 317..373 CDD:459649 16/54 (30%)
HMRA1NP_010021.1 HOX 70..126 CDD:197696 16/55 (29%)

Return to query results.
Submit another query.