| Sequence 1: | NP_650701.1 | Gene: | CG18599 / 42191 | FlyBaseID: | FBgn0038592 | Length: | 475 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_177248.3 | Gene: | HB18 / 843431 | AraportID: | AT1G70920 | Length: | 206 | Species: | Arabidopsis thaliana |
| Alignment Length: | 55 | Identity: | 16/55 - (29%) |
|---|---|---|---|
| Similarity: | 19/55 - (34%) | Gaps: | 23/55 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 115 GPPGCRGEPGPSGLPGRRGINNYETLPLKKCIWRERLACIMCPRGPPGRRGRMGD 169 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18599 | NP_650701.1 | Homeodomain | 317..373 | CDD:459649 | |
| HB18 | NP_177248.3 | HOX | 66..122 | CDD:197696 | |
| HALZ | 124..167 | CDD:128634 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||