DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and HB18

DIOPT Version :10

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_177248.3 Gene:HB18 / 843431 AraportID:AT1G70920 Length:206 Species:Arabidopsis thaliana


Alignment Length:55 Identity:16/55 - (29%)
Similarity:19/55 - (34%) Gaps:23/55 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GPPGCRGEPGPSGLPGRRGINNYETLPLKKCIWRERLACIMCPRGPPGRRGRMGD 169
            |....|||  |.|:..||         .||.:            |..|||.|.|:
plant     2 GDESLRGE--PVGVDRRR---------KKKDV------------GEIGRRFRCGE 33

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeodomain 317..373 CDD:459649
HB18NP_177248.3 HOX 66..122 CDD:197696
HALZ 124..167 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.