DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and HB22

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_850266.1 Gene:HB22 / 818233 AraportID:AT2G36610 Length:185 Species:Arabidopsis thaliana


Alignment Length:100 Identity:30/100 - (30%)
Similarity:50/100 - (50%) Gaps:17/100 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 KSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQ-------QYMVGPER-LYLAHTLKLTEAQVK 361
            :|:|......|.|::    |.|||:.||..|:.:       :..:.|:| :.|:..|.|...|:.
plant    61 ESNSFNGQEKKKKKM----TSEQLKFLERSFQEEIKLNPDRKMKLNPDRKMKLSKELGLQPRQIA 121

  Fly   362 VWFQNRRIKWRKHHLE-----LTQQRLALIRQTQL 391
            ||||||:.:|:...||     |.|:...:.|:.:|
plant   122 VWFQNRKARWKNKQLEHLYESLRQEFDIVSREKEL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 19/59 (32%)
HB22NP_850266.1 Homeobox 76..133 CDD:395001 20/56 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.