DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and HAT9

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_179865.1 Gene:HAT9 / 816811 AraportID:AT2G22800 Length:274 Species:Arabidopsis thaliana


Alignment Length:77 Identity:24/77 - (31%)
Similarity:38/77 - (49%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 EKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQN 366
            |::.||.|:.....:.|.:...|.:|...||..|:....:...::..||..|.|...||:|||||
plant    96 ERVISDYHEDEEGISARKKLRLTKQQSALLEESFKDHSTLNPKQKQVLARQLNLRPRQVEVWFQN 160

  Fly   367 RRIKWRKHHLEL 378
            ||.:.:....|:
plant   161 RRARTKLKQTEV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 18/51 (35%)
HAT9NP_179865.1 HOX 112..166 CDD:197696 19/53 (36%)
HALZ 168..211 CDD:128634 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.