DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and HB6

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 / 816775 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana


Alignment Length:248 Identity:55/248 - (22%)
Similarity:96/248 - (38%) Gaps:45/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 AVAAAVGAAPSALQSLQQLHQQHHAQQQATLSFQREK----LKSDSHKKSALKNKRVRTIFTPEQ 327
            :|...:...|:.....|...:....:.|:.|....|:    ::...|...:.|.:|:    :..|
plant    10 SVGGLISLCPTTSTDEQSPRRYGGREFQSMLEGYEEEEEAIVEERGHVGLSEKKRRL----SINQ 70

  Fly   328 LECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLE--------------- 377
            ::.||..||.:..:....::.||..|.|...||.|||||||.:|:...||               
plant    71 VKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKTQYDSLRH 135

  Fly   378 ----LTQQRLALIRQTQLPGTSLLG---------NQVSVSANAAHSVSTER-------TNGCSAA 422
                |.:...:|:::.....|.|.|         |..:|:..:..||..|.       |...|:.
plant   136 NFDSLRRDNESLLQEISKLKTKLNGGGGEEEEEENNAAVTTESDISVKEEEVSLPEKITEAPSSP 200

  Fly   423 SPSLQEEDNEDSKHSLSLSGALPPLSRAQSESDLSICNDSLDGDSLMDGSEEA 475
            ...|:..|..:.:....|...||..:.|.|.:..:..:||.|..:|:  :||:
plant   201 PQFLEHSDGLNYRSFTDLRDLLPLKAAASSFAAAAGSSDSSDSSALL--NEES 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 18/51 (35%)
HB6NP_565536.1 Homeobox 62..115 CDD:278475 20/56 (36%)
HALZ 117..158 CDD:280364 5/40 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.