DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Noto

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001178943.1 Gene:Noto / 502857 RGDID:1562910 Length:245 Species:Rattus norvegicus


Alignment Length:141 Identity:49/141 - (34%)
Similarity:70/141 - (49%) Gaps:39/141 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 PSALQSLQQ---LHQQHHAQQQATLSFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFER 337
            ||.|..|::   ::.|.|              .::.|:      |||||:|:.:||..||..|.:
  Rat   131 PSCLGPLKRAPTVNLQDH--------------NTERHQ------KRVRTMFSEQQLGELEKVFAK 175

  Fly   338 QQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQRL------ALIRQTQLPGTSL 396
            |..:||.||..||..|.|||.||::||||||:|::|      ||:|      |:    :.|..|.
  Rat   176 QHNLVGKERAQLAARLHLTENQVRIWFQNRRVKYQK------QQKLKSPPPDAM----EEPSNSS 230

  Fly   397 LGNQVSVSANA 407
            .||..:..|.|
  Rat   231 EGNVRNEDAEA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 28/51 (55%)
NotoNP_001178943.1 Homeobox 158..209 CDD:278475 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341722
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.