DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Emx1

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_575584.5 Gene:Emx1 / 500235 RGDID:1564002 Length:290 Species:Rattus norvegicus


Alignment Length:282 Identity:80/282 - (28%)
Similarity:104/282 - (36%) Gaps:90/282 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 ATATSHAQLIEAAAAHSSLDVGKSFTIAAILGLQSQRKDYNNAINLSLHDNNNIIGDDNNKCYTS 211
            |.|..|.....|...|||......|..|...|...:                :::..|       
  Rat    11 AAAPGHRAFPRAPLPHSSSAAATMFQPATKRGFTIE----------------SLVAKD------- 52

  Fly   212 NPNNNNNNNNNGGSNS---------------GNNNSSPS------VNNFNCDSVAGNGRYLHGGH 255
              .....:..:||:.|               ..|...||      |:.|...:.||..|.|:||.
  Rat    53 --GGTGGSPGSGGAGSHPLAVAASEEPLRPTALNYPHPSAAETAFVSGFPAAAAAGASRSLYGGP 115

  Fly   256 Q--------HP----HP-HQAGFAAVAAAVGAAPSALQSLQQLHQQHHAQQQATL---------- 297
            :        ||    || ||.|.:              |||..|....||.:..|          
  Rat   116 ELVFPEAMNHPALTVHPAHQLGSS--------------SLQPPHSFFSAQHRDPLHFYPWVLRNR 166

  Fly   298 ----SFQREKLKSDS---HKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKL 355
                .||..::..|.   |...|.|.||:||.|:|.||..||..||:..|:||.||..||.:|.|
  Rat   167 FFGHRFQASEVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSL 231

  Fly   356 TEAQVKVWFQNRRIKWRKHHLE 377
            :|.||||||||||.|:::..||
  Rat   232 SETQVKVWFQNRRTKYKRQKLE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 31/51 (61%)
Emx1XP_575584.5 COG5576 141..>251 CDD:227863 45/109 (41%)
Homeobox 196..248 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.