DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and dlx5

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001004778.1 Gene:dlx5 / 447997 XenbaseID:XB-GENE-853057 Length:289 Species:Xenopus tropicalis


Alignment Length:268 Identity:68/268 - (25%)
Similarity:105/268 - (39%) Gaps:76/268 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 NNSSPSVNNFNCDSVAGNGRYLHGGHQHPHPHQAGFAAVAAAVGAAPSALQSLQQLH-------- 286
            :..||::.    :|.|.:..|...|....|||....:..:|..|.|.:|.|  .|.|        
 Frog    25 SQDSPTLP----ESTATDSGYYSPGGAAGHPHHGYCSPTSATYGKALNAYQ--YQYHGMNGAAGN 83

  Fly   287 ------------QQHHAQQQATLSFQREKLKSDSHKKSA------------LKNKRVRTIFTPEQ 327
                        ..:|...|.:.::.|.:..|...:|..            .|.::.|||::..|
 Frog    84 YPGKAYSDYGYGSPYHPHHQYSGAYNRVQPPSSQPEKEVSEPEVRMVNGKPKKIRKPRTIYSSFQ 148

  Fly   328 LECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQLP 392
            |..|:..|::.||:..|||..||.:|.||:.|||:||||:|.|.:|           :::..:||
 Frog   149 LAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKK-----------IMKNGELP 202

  Fly   393 GTSLLGNQVSVSANAAHSVSTERTNGC-SAASPSLQEEDNEDSKHSLS----------LSGALPP 446
                          ..||.|:.....| |..||.:.|.  :.|..|||          .||:.|.
 Frog   203 --------------PEHSPSSSDPMACNSPQSPVVWEP--QGSSRSLSHHPHVHSHPQASGSSPA 251

  Fly   447 LSRAQSES 454
            .|..::.|
 Frog   252 SSYLENSS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 26/51 (51%)
dlx5NP_001004778.1 DLL_N 26..118 CDD:315147 20/97 (21%)
Homeobox 140..193 CDD:306543 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.