DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and CG15696

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster


Alignment Length:128 Identity:36/128 - (28%)
Similarity:62/128 - (48%) Gaps:16/128 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 HPHPHQAGFAAVAAAVGAAPSALQSLQQL-------HQQHHAQQQATLSFQREKLKSDSHKKSAL 314
            ||:.|.|.:  |:...|.:|.|..:..|:       :.::|..:..      ..|:.::..|.. 
  Fly    37 HPYAHPASY--VSKESGGSPPASAAEAQIPVYDWLQYTRYHPPKLP------RALRQNAPAKRT- 92

  Fly   315 KNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLE 377
            ..:..|..|||:||:.||..::...|:...:...||.:|:||..:||:||||||.:.|:...|
  Fly    93 PGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKRE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 22/51 (43%)
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 18/46 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I3229
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.