DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and cdx1a

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_998001.2 Gene:cdx1a / 405762 ZFINID:ZDB-GENE-050510-1 Length:228 Species:Danio rerio


Alignment Length:227 Identity:63/227 - (27%)
Similarity:100/227 - (44%) Gaps:45/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 YTSNPNNNNNNNNNGGSNS-----GNNNSSPSVNNFNCDSVAGNGRYLHG-GHQHPHPHQAGFAA 267
            |...|...|:.::.|.|.|     |:.:..|.:             |.|| ||..|        |
Zfish    40 YHPGPALGNDLHHTGSSWSPGFGPGSRDDWPPL-------------YGHGTGHSLP--------A 83

  Fly   268 VAAAVGAAPSALQSLQQLHQQHHAQQQATLSFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLE 332
            ....|...||..|.|.........:.|..:  :|..:.::...|:..|:| .|.:::..|...||
Zfish    84 NGVEVSVLPSVDQGLLSGAPVDREEPQDWM--RRSAVPTNPGGKTRTKDK-YRVVYSDVQRLELE 145

  Fly   333 AEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQLPGTSLL 397
            .||...:|:....:..||.||.|:|.|||:||||||.|.||    :.::||..::|:    :|.|
Zfish   146 KEFHFSRYITIRRKAELAGTLNLSERQVKIWFQNRRAKERK----MNKKRLQQVQQS----SSGL 202

  Fly   398 GNQVSVSANAAHSVSTERTNGCSAASPSLQEE 429
            .|..:||::.: .:.|:.      .|.|::||
Zfish   203 ANTTTVSSSDS-GLMTDN------ISSSIKEE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 23/51 (45%)
cdx1aNP_998001.2 Caudal_act 11..115 CDD:282574 21/97 (22%)
COG5576 <122..227 CDD:227863 39/120 (33%)
Homeobox 133..185 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.