DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Noto

DIOPT Version :10

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001007473.1 Gene:Noto / 384452 MGIID:3053002 Length:240 Species:Mus musculus


Alignment Length:133 Identity:28/133 - (21%)
Similarity:42/133 - (31%) Gaps:58/133 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ALSLNVKKSVA--------EF-SVATNFAWEQIATLNELHLVSKR---------GIS--KKSVFV 82
            :||.::.:::|        || |.....|.::.......|||:.|         ||:  ..:||:
Mouse   116 SLSHSILRTIAPTGHLHTVEFHSQRAEKAMQEFKEHKVSHLVTVRNQDVCKDGFGITGVADAVFL 180

  Fly    83 DRIFRSPFNQIA---------------TLPPWCQCEPIRPKCPPG----------PPGPPGCRGE 122
            |  ..||:..|:               ...||           ||          ..||...|..
Mouse   181 D--IPSPWEAISHAKKALKYKGCTHTGLSEPW-----------PGRSSLLILTMYRAGPENLRSF 232

  Fly   123 PGP 125
            .||
Mouse   233 IGP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeodomain 317..373 CDD:459649
NotoNP_001007473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Homeodomain 150..206 CDD:459649 12/57 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..240 9/39 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.