DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Dll

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster


Alignment Length:265 Identity:79/265 - (29%)
Similarity:115/265 - (43%) Gaps:64/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 NSGNNNSS--PSVNNFNCDSVAGNGRYL---------HGG----HQHPHP---HQAGFAAVAAAV 272
            :.||..:|  |.:|      :.|...::         :||    :||..|   ..:||.:..:|:
  Fly    14 DGGNTAASVTPGIN------IPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSAL 72

  Fly   273 G--AAPSALQSLQQLHQQHHAQQQATLSFQREKLK-SDSHKKSAL-------KNKRVRTIFTPEQ 327
            |  ..|....|....|...:|...|  |..::... ||..:.|.|       |.::.|||::..|
  Fly    73 GYPFPPMHQNSYSGYHLGSYAPPCA--SPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQ 135

  Fly   328 LECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQLP 392
            |:.|...|:|.||:..|||..||.:|.||:.|||:||||||.|::|           :::..|.|
  Fly   136 LQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKK-----------MMKAAQGP 189

  Fly   393 GTSL---LG----NQVSVSANAAHS--VSTER-------TNGCSAASPSLQEEDNEDSKHSLSLS 441
            ||:.   ||    |....|.|..||  ::..|       |||..|...| ...:|....:|.|.|
  Fly   190 GTNSGMPLGGGGPNPGQHSPNQMHSGELANGRFLWAALETNGTLALVHS-TGGNNGGGSNSGSPS 253

  Fly   442 GALPP 446
            ..|||
  Fly   254 HYLPP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 28/51 (55%)
DllNP_001137759.1 Homeobox 127..180 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.