DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and vax2

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_919390.1 Gene:vax2 / 373869 ZFINID:ZDB-GENE-030904-8 Length:307 Species:Danio rerio


Alignment Length:173 Identity:67/173 - (38%)
Similarity:80/173 - (46%) Gaps:37/173 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 KRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQ 381
            ||.||.||.|||..||.||:|.||:||.||..||..|.|:|.||||||||||.|.:|...:.|.:
Zfish   104 KRTRTSFTAEQLYRLELEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQTKDTDK 168

  Fly   382 R-------------LALIRQTQL----------------PGT-SLLGNQVSVSANAAHSVST--- 413
            |             |.|:.|.:|                ||. ||||:. |||.::..|.||   
Zfish   169 RSSSTSESLATCNILRLLEQGRLLSVPAPPPNPLLAHPHPGNGSLLGSP-SVSTSSGVSSSTTPP 232

  Fly   414 ---ERTNGCSAASPSLQEEDNEDSKHSLSLSGALPPLSRAQSE 453
               ..|.|.|.:|.|.............||...:|.||.|..|
Zfish   233 GAGSGTFGLSLSSLSGTPPSPRLGVPPPSLCFTMPLLSGAHHE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 34/51 (67%)
vax2NP_919390.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
Homeobox 106..159 CDD:278475 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..175 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..254 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24339
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.