DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and cad

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:528 Identity:123/528 - (23%)
Similarity:179/528 - (33%) Gaps:213/528 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PSKYHANPLSHFLALHNTQASGGGSGGGSSVAGLGGLGGGIHAHGQPHHAALA------------ 57
            |:.:|..|...||                         |.:.:....||||.|            
  Fly    34 PNYHHTPPNHQFL-------------------------GDVDSSHAAHHAAAAHQMYYNSHHMFH 73

  Fly    58 AAAAAAVAVSAGQSSYQMEHQQQHHQLQQQQQQQQHHHHQQLHTHHQDGHHPHPPTPTTGNNNNN 122
            :||||:.......:|...::..|:......|..||||||   |.|                 .::
  Fly    74 SAAAASAGEWHSPASSTADNFVQNVPTSAHQLMQQHHHH---HAH-----------------ASS 118

  Fly   123 SSSSSNSSS----------HNSNS--------------------------NHREQLA-------- 143
            ||:||.|||          :.:||                          ||::.:|        
  Fly   119 SSASSGSSSSGGAPGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPI 183

  Fly   144 -AAAATATSHAQLIEAAAAHSSLDVGKSFTIAAILGLQSQRKDYNNAINLSLHDNNNIIGDDNNK 207
             .:.:..:|......|::.|..|                       |.:||...||         
  Fly   184 TVSGSEISSPGAPTSASSPHHHL-----------------------AHHLSAVANN--------- 216

  Fly   208 CYTSNPNNNNNNNNNGGSNSGNNNSSPSVNNFNCDSVAGNGRYLHGGHQHPHPHQAGFAAVAAAV 272
                  |||||||||..|...|||::.||:|.|..| .....|.....:..:|.|.     ...:
  Fly   217 ------NNNNNNNNNSPSTHNNNNNNNSVSNNNRTS-PSKPPYFDWMKKPAYPAQP-----QPDL 269

  Fly   273 GAAPSALQSLQQLHQQHHAQQQATLSFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFER 337
            .::|: |:.|..|                    .|:..|:..|:| .|.::|..|...||.|:..
  Fly   270 SSSPN-LEDLSDL--------------------LDASGKTRTKDK-YRVVYTDFQRLELEKEYCT 312

  Fly   338 QQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRK---------------HHLELTQQRLALIR 387
            .:|:....:..||.||.|:|.|||:||||||.|.||               .|.:.:|   .|..
  Fly   313 SRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQ---LLDA 374

  Fly   388 QTQL-PGTSLLGNQVSVSAN----------------AAHSVSTERTNGCSAASPSLQEEDNEDSK 435
            :.:| ||.. |.:.::.|.|                ||||.|..   ..:|.|..||::      
  Fly   375 KAKLEPGLH-LSHSLAHSMNPMAAMNIPAMRLHPHLAAHSHSLA---AVAAHSHQLQQQ------ 429

  Fly   436 HSLSLSGA 443
            ||..:|.|
  Fly   430 HSAQMSAA 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 23/51 (45%)
cadNP_001260641.1 Homeobox 295..347 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.