DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and NOTO

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001127934.1 Gene:NOTO / 344022 HGNCID:31839 Length:251 Species:Homo sapiens


Alignment Length:118 Identity:46/118 - (38%)
Similarity:63/118 - (53%) Gaps:26/118 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 KNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELT 379
            :.|||||:|..||||.||..|.:|..:||.:|..||..|||||.||:|||||||:|::|      
Human   155 QQKRVRTMFNLEQLEELEKVFAKQHNLVGKKRAQLAARLKLTENQVRVWFQNRRVKYQK------ 213

  Fly   380 QQRLALIRQTQLPGTSLLGNQVSVSANAAHSVSTERTNGCSAASPSLQEEDNE 432
            ||:|                  ..:..:|.:.|.:..:..|.|  |:|.:|.|
Human   214 QQKL------------------RAAVTSAEAASLDEPSSSSIA--SIQSDDAE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 31/51 (61%)
NOTONP_001127934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
Homeobox 160..211 CDD:278475 30/50 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 224..251 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147864
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11897
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.