DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and HOXC10

DIOPT Version :10

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_059105.2 Gene:HOXC10 / 3226 HGNCID:5122 Length:342 Species:Homo sapiens


Alignment Length:125 Identity:35/125 - (28%)
Similarity:65/125 - (52%) Gaps:5/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 QHPHPHQAGFAAVAAAVGAAPSALQSLQQLHQQHHAQQQATLSFQREKLKSDS---HKKSALKNK 317
            |.|.|::.......|....:||  :|.::..:...:....:.:..:|::|:::   :..:|...:
Human   207 QTPSPNEIKTEQSLAGPKGSPS--ESEKERAKAADSSPDTSDNEAKEEIKAENTTGNWLTAKSGR 269

  Fly   318 RVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLE 377
            :.|..:|..|...||.||....|:....||.::.|:.||:.|||:||||||:|.:|.:.|
Human   270 KKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeodomain 317..373 CDD:459649 23/55 (42%)
HOXC10NP_059105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..271 10/65 (15%)
Homeodomain 269..325 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.