DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and dlx5a

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_571381.2 Gene:dlx5a / 30569 ZFINID:ZDB-GENE-990415-49 Length:282 Species:Danio rerio


Alignment Length:210 Identity:54/210 - (25%)
Similarity:84/210 - (40%) Gaps:55/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 GNNNSSPSVNNFNCDSVAGNGRYLHGGHQHPHPHQAGFAAVAAAVGAAPSALQSLQQLHQQHHAQ 292
            |.|.||   .|::..|....|.|....||        :|.....|.:.||.       .::..|:
Zfish    78 GVNGSS---GNYSAKSYPDYGSYSTAYHQ--------YAGTYNRVQSQPSP-------QEKETAE 124

  Fly   293 QQATLSFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTE 357
            .:..:...:.|           |.::.|||::..||..|:..|:..||:..|||..||.:|.||:
Zfish   125 PEVRMVNGKPK-----------KVRKPRTIYSSFQLAALQRRFQNTQYLALPERAELAASLGLTQ 178

  Fly   358 AQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQLPGTSLLGNQVSVSANAAHSVSTERTNGC-SA 421
            .|||:||||:|.|.:|           :::..:||              ..||.|:.....| |.
Zfish   179 TQVKIWFQNKRSKLKK-----------IMKNGELP--------------PEHSPSSSDPMACNSP 218

  Fly   422 ASPSLQEEDNEDSKH 436
            .||::.:.......|
Zfish   219 QSPAVWDSQGPQRPH 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 26/51 (51%)
dlx5aNP_571381.2 DLL_N 31..118 CDD:289198 14/57 (25%)
Homeobox 140..193 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.