DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and dlx1a

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_571380.1 Gene:dlx1a / 30568 ZFINID:ZDB-GENE-990415-48 Length:252 Species:Danio rerio


Alignment Length:206 Identity:57/206 - (27%)
Similarity:90/206 - (43%) Gaps:56/206 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 NGRY-LHGGHQHPHP-HQAGFAAVAA-----------AVGA-APSALQSLQQLHQQHHAQQQATL 297
            :|.| :|..|...|| |.:.::...:           :||: :.|...|..|.:..:.|..|..|
Zfish    37 HGHYSMHCLHSSGHPQHDSAYSPAPSFPRSLPYPYVNSVGSHSSSPYLSTVQTYPNNSALAQTRL 101

  Fly   298 SFQREKLKSDSHKKSAL---------KNKRV---RTIFTPEQLECLEAEFERQQYMVGPERLYLA 350
                |....:|.|.:.:         |.|::   |||::..||:.|...|::.||:..|||..||
Zfish   102 ----EDPAPESEKNTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELA 162

  Fly   351 HTLKLTEAQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQLPGTSLLGNQVSVSANAAHSVSTER 415
            .:|.||:.|||:||||:|.|::|           |::|.        |..:..:|.|       .
Zfish   163 ASLGLTQTQVKIWFQNKRSKFKK-----------LMKQG--------GGTIDTNALA-------N 201

  Fly   416 TNGCSAASPSL 426
            ..|.|..|||:
Zfish   202 GRGLSTGSPSV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 26/51 (51%)
dlx1aNP_571380.1 COG5576 <124..233 CDD:227863 39/115 (34%)
Homeobox 131..184 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.